IgFold: Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies.
“IgFold is a structure prediction tool for heavy-light chain antibody structures. IgFold utilizes a novel approach to train a natural language model on 558M natural antibody sequences to predict structures that are more accurate than AlphaFold (and faster!)
Running IgFold on COSMIC²
To run IgFold:
- Create a plain text file that has two entries: H & L.
- Upload this file using the web browser upload
- Click through tool creation. (There are no options to specify)
- Then click submit
The job will finish in 20-30 minutes.
Output files
IgFold will output a predicted antibody structure (“my_antibody.pdb”) that will appear on the output data page.
Example IgFold FASTA file contents:
>H EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS >L DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK
Reference
Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies
